SCOP 1.73: Domain d2clob1: 2clo B:3-392

Lineage for d2clob1 (2clo B:3-392)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (42 PDB entries)

8. Domain d2clob1: 2clo B:3-392 [130585]
   Other proteins in same PDB: d2cloa1
   automatically matched to d1bksb_
   complexed with f19, na, pls

Details for d2clob1

PDB Entry: 2clo, 1.5 Å

PDB Description: tryptophan synthase (external aldimine state) in complex with (naphthalene-2'-sulfonyl)-2-amino-1-ethylphosphate (f19)

PDB Compounds: (B:) tryptophan synthase beta chain

SCOP Domain Sequences for d2clob1:

Sequence; same for both SEQRES and ATOM records:

>d2clob1 c.79.1.1 (B:3-392) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 602]}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdilk

Timeline for d2clob1:

• d2clob1 is new in SCOP 1.73
  
• d2clob1 appears in SCOP 1.75
  
• d2clob1 appears in the current release, SCOPe 2.08, called d2clob_