Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
Protein automated matches [190053] (10 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [189632] (10 PDB entries) |
Domain d2cloa_: 2clo A: [130584] Other proteins in same PDB: d2clob_ automated match to d1a5aa_ complexed with f19, na, pls |
PDB Entry: 2clo (more details), 1.5 Å
SCOPe Domain Sequences for d2cloa_:
Sequence, based on SEQRES records: (download)
>d2cloa_ c.1.2.4 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]} eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg vtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkii eknlaspkqmlaelrsfvsamkaasra
>d2cloa_ c.1.2.4 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]} eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg vtghhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkq mlaelrsfvsamkaasra
Timeline for d2cloa_: