Lineage for d2clma_ (2clm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079697Protein automated matches [190053] (9 species)
    not a true protein
  7. 2079714Species Salmonella typhimurium [TaxId:90371] [189632] (10 PDB entries)
  8. 2079717Domain d2clma_: 2clm A: [130582]
    Other proteins in same PDB: d2clmb_
    automated match to d1a5aa_
    complexed with f6f, na, pls

Details for d2clma_

PDB Entry: 2clm (more details), 1.51 Å

PDB Description: tryptophan synthase (external aldimine state) in complex with n-(4'-trifluoromethoxybenzoyl)-2-amino-1-ethylphosphate (f6f)
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d2clma_:

Sequence, based on SEQRES records: (download)

>d2clma_ c.1.2.4 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
vtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkii
eknlaspkqmlaelrsfvsamkaasra

Sequence, based on observed residues (ATOM records): (download)

>d2clma_ c.1.2.4 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllshhl
ieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqmlaelr
sfvsamkaasra

SCOPe Domain Coordinates for d2clma_:

Click to download the PDB-style file with coordinates for d2clma_.
(The format of our PDB-style files is described here.)

Timeline for d2clma_: