![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
![]() | Protein automated matches [190053] (10 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:90371] [189632] (10 PDB entries) |
![]() | Domain d2clma_: 2clm A: [130582] Other proteins in same PDB: d2clmb_ automated match to d1a5aa_ complexed with f6f, na, pls |
PDB Entry: 2clm (more details), 1.51 Å
SCOPe Domain Sequences for d2clma_:
Sequence, based on SEQRES records: (download)
>d2clma_ c.1.2.4 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]} eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg vtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkii eknlaspkqmlaelrsfvsamkaasra
>d2clma_ c.1.2.4 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]} eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllshhl ieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqmlaelr sfvsamkaasra
Timeline for d2clma_: