Lineage for d2clla1 (2cll A:2-267)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681300Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 681489Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)
  6. 681519Protein Trp synthase alpha-subunit [51388] (5 species)
  7. 681543Species Salmonella typhimurium [TaxId:90371] [51389] (42 PDB entries)
  8. 681555Domain d2clla1: 2cll A:2-267 [130580]
    Other proteins in same PDB: d2cllb1
    automatically matched to d1k3ua_
    complexed with f9f, na, pls

Details for d2clla1

PDB Entry: 2cll (more details), 1.6 Å

PDB Description: tryptophan synthase (external aldimine state) in complex with n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9)

SCOP Domain Sequences for d2clla1:

Sequence, based on SEQRES records: (download)

>d2clla1 c.1.2.4 (A:2-267) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 602]}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
vtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkii
eknlaspkqmlaelrsfvsamkaasr

Sequence, based on observed residues (ATOM records): (download)

>d2clla1 c.1.2.4 (A:2-267) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 602]}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
vtghhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkq
mlaelrsfvsamkaasr

SCOP Domain Coordinates for d2clla1:

Click to download the PDB-style file with coordinates for d2clla1.
(The format of our PDB-style files is described here.)

Timeline for d2clla1: