Lineage for d2clkb_ (2clk B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907681Protein automated matches [190054] (13 species)
    not a true protein
  7. 2907778Species Salmonella typhimurium [TaxId:90371] [189633] (15 PDB entries)
  8. 2907780Domain d2clkb_: 2clk B: [130579]
    Other proteins in same PDB: d2clka_
    automated match to d2tysb_
    complexed with g3h, na, plp

Details for d2clkb_

PDB Entry: 2clk (more details), 1.5 Å

PDB Description: tryptophan synthase in complex with d-glyceraldehyde 3-phosphate (g3p)
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d2clkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2clkb_ c.79.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdil

SCOPe Domain Coordinates for d2clkb_:

Click to download the PDB-style file with coordinates for d2clkb_.
(The format of our PDB-style files is described here.)

Timeline for d2clkb_: