SCOP 1.75: Domain d2clka1: 2clk A:1-267

Lineage for d2clka1 (2clk A:1-267)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)

6. Protein Trp synthase alpha-subunit [51388] (5 species)

7. Species Salmonella typhimurium [TaxId:90371] [51389] (49 PDB entries)

8. Domain d2clka1: 2clk A:1-267 [130578]
   Other proteins in same PDB: d2clkb1
   automatically matched to d1k8xa_
   complexed with g3h, na, plp

Details for d2clka1

PDB Entry: 2clk, 1.5 Å

PDB Description: tryptophan synthase in complex with d-glyceraldehyde 3-phosphate (g3p)

PDB Compounds: (A:) tryptophan synthase alpha chain

SCOP Domain Sequences for d2clka1:

Sequence; same for both SEQRES and ATOM records:

>d2clka1 c.1.2.4 (A:1-267) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlaiirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasr

Timeline for d2clka1:

• d2clka1 first appeared in SCOP 1.73
  
• d2clka1 is called d2clka_ in SCOPe 2.01
  
• d2clka1 appears in the current release, SCOPe 2.08, called d2clka_