Lineage for d2clka_ (2clk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827194Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2827352Protein automated matches [190053] (10 species)
    not a true protein
  7. 2827380Species Salmonella typhimurium [TaxId:90371] [189632] (10 PDB entries)
  8. 2827381Domain d2clka_: 2clk A: [130578]
    Other proteins in same PDB: d2clkb_
    automated match to d1k3ua_
    complexed with g3h, na, plp

Details for d2clka_

PDB Entry: 2clk (more details), 1.5 Å

PDB Description: tryptophan synthase in complex with d-glyceraldehyde 3-phosphate (g3p)
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d2clka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2clka_ c.1.2.4 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlaiirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasr

SCOPe Domain Coordinates for d2clka_:

Click to download the PDB-style file with coordinates for d2clka_.
(The format of our PDB-style files is described here.)

Timeline for d2clka_: