![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
![]() | Protein Tryptophan synthase, beta-subunit [53688] (4 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [53689] (66 PDB entries) |
![]() | Domain d2clhb1: 2clh B:3-394 [130575] Other proteins in same PDB: d2clha1 automatically matched to d1bksb_ complexed with f19, na, plp |
PDB Entry: 2clh (more details), 1.7 Å
SCOPe Domain Sequences for d2clhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clhb1 c.79.1.1 (B:3-394) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm reqpekeqllvvnlsgrgdkdiftvhdilkar
Timeline for d2clhb1: