Lineage for d2clea1 (2cle A:2-267)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079595Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2079644Species Salmonella typhimurium [TaxId:90371] [51389] (46 PDB entries)
  8. 2079649Domain d2clea1: 2cle A:2-267 [130572]
    Other proteins in same PDB: d2cleb1
    automatically matched to d1k3ua_
    complexed with f6f, na, plp

Details for d2clea1

PDB Entry: 2cle (more details), 1.5 Å

PDB Description: tryptophan synthase in complex with n-(4'-trifluoromethoxybenzoyl)-2-amino-1-ethylphosphate (f6) -lowf6 complex
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d2clea1:

Sequence, based on SEQRES records: (download)

>d2clea1 c.1.2.4 (A:2-267) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
vtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkii
eknlaspkqmlaelrsfvsamkaasr

Sequence, based on observed residues (ATOM records): (download)

>d2clea1 c.1.2.4 (A:2-267) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllshhl
ieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqmlaelr
sfvsamkaasr

SCOPe Domain Coordinates for d2clea1:

Click to download the PDB-style file with coordinates for d2clea1.
(The format of our PDB-style files is described here.)

Timeline for d2clea1: