Lineage for d2cl5b_ (2cl5 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1864484Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 1864539Protein automated matches [190251] (4 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187033] (8 PDB entries)
  8. 1864553Domain d2cl5b_: 2cl5 B: [130571]
    automated match to d1h1da_
    complexed with bie, bu3, mes, mg, sam

Details for d2cl5b_

PDB Entry: 2cl5 (more details), 1.6 Å

PDB Description: catechol-o-methyltransferase in complex with an inhibitor
PDB Compounds: (B:) Catechol O-methyltransferase

SCOPe Domain Sequences for d2cl5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cl5b_ c.66.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mgdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireysps
lvlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasq
dlipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfl
ayvrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d2cl5b_:

Click to download the PDB-style file with coordinates for d2cl5b_.
(The format of our PDB-style files is described here.)

Timeline for d2cl5b_: