SCOP 1.73: Domain d2cl5b1: 2cl5 B:3-215

Lineage for d2cl5b1 (2cl5 B:3-215)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.1: COMT-like [53336] (3 proteins)

6. Protein Catechol O-methyltransferase, COMT [53337] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [53338] (4 PDB entries)

8. Domain d2cl5b1: 2cl5 B:3-215 [130571]
   automatically matched to d1h1da_
   complexed with bie, bu3, mes, mg, sam

Details for d2cl5b1

PDB Entry: 2cl5, 1.6 Å

PDB Description: catechol-o-methyltransferase in complex with an inhibitor

PDB Compounds: (B:) Catechol O-methyltransferase

SCOP Domain Sequences for d2cl5b1:

Sequence; same for both SEQRES and ATOM records:

>d2cl5b1 c.66.1.1 (B:3-215) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp

Timeline for d2cl5b1:

• d2cl5b1 is new in SCOP 1.73
  
• d2cl5b1 appears in SCOP 1.75
  
• d2cl5b1 appears in the current release, SCOPe 2.08, called d2cl5b_