![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) ![]() |
![]() | Family c.66.1.1: COMT-like [53336] (3 proteins) |
![]() | Protein Catechol O-methyltransferase, COMT [53337] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [53338] (4 PDB entries) |
![]() | Domain d2cl5b1: 2cl5 B:3-215 [130571] automatically matched to d1h1da_ complexed with bie, bu3, mes, mg, sam |
PDB Entry: 2cl5 (more details), 1.6 Å
SCOP Domain Sequences for d2cl5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cl5b1 c.66.1.1 (B:3-215) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay vrgsssfecthyssyleymkvvdglekaiyqgp
Timeline for d2cl5b1: