SCOPe 2.08: Domain d2cl5b_: 2cl5 B:

Lineage for d2cl5b_ (2cl5 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.1: COMT-like [53336] (4 proteins)

6. Protein automated matches [190251] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187033] (8 PDB entries)

8. Domain d2cl5b_: 2cl5 B: [130571]
   automated match to d1h1da_
   complexed with bie, bu3, mes, mg, sam

Details for d2cl5b_

PDB Entry: 2cl5, 1.6 Å

PDB Description: catechol-o-methyltransferase in complex with an inhibitor

PDB Compounds: (B:) Catechol O-methyltransferase

SCOPe Domain Sequences for d2cl5b_:

Sequence; same for both SEQRES and ATOM records:

>d2cl5b_ c.66.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mgdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireysps
lvlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasq
dlipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfl
ayvrgsssfecthyssyleymkvvdglekaiyqgp

Timeline for d2cl5b_:

• d2cl5b_ first appeared in SCOP 1.73, called d2cl5b1
  
• d2cl5b_ appears in SCOPe 2.07