SCOPe 2.07: Domain d2cl5a_: 2cl5 A:

Lineage for d2cl5a_ (2cl5 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.1: COMT-like [53336] (4 proteins)

6. Protein automated matches [190251] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187033] (8 PDB entries)

8. Domain d2cl5a_: 2cl5 A: [130570]
   automated match to d1h1da_
   complexed with bie, bu3, mes, mg, sam

Details for d2cl5a_

PDB Entry: 2cl5, 1.6 Å

PDB Description: catechol-o-methyltransferase in complex with an inhibitor

PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d2cl5a_:

Sequence; same for both SEQRES and ATOM records:

>d2cl5a_ c.66.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspsl
vlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqd
lipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfla
yvrgsssfecthyssyleymkvvdglekaiyqgps

Timeline for d2cl5a_:

• d2cl5a_ first appeared in SCOP 1.73, called d2cl5a1
  
• d2cl5a_ appears in SCOPe 2.06
  
• d2cl5a_ appears in the current release, SCOPe 2.08