SCOPe 2.02: Domain d2ckha1: 2ckh A:419-643

Lineage for d2ckha1 (2ckh A:419-643)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 1 [142862] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142863] (6 PDB entries)
   Uniprot Q9P0U3 419-643

8. Domain d2ckha1: 2ckh A:419-643 [130565]
   Other proteins in same PDB: d2ckhb1

Details for d2ckha1

PDB Entry: 2ckh, 3.2 Å

PDB Description: senp1-sumo2 complex

PDB Compounds: (A:) sentrin-specific protease 1

SCOPe Domain Sequences for d2ckha1:

Sequence; same for both SEQRES and ATOM records:

>d2ckha1 d.3.1.7 (A:419-643) Sentrin-specific protease 1 {Human (Homo sapiens) [TaxId: 9606]}
efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqipqqmn
gsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll

Timeline for d2ckha1:

• d2ckha1 first appeared in SCOP 1.73
  
• d2ckha1 appears in SCOPe 2.01
  
• d2ckha1 appears in SCOPe 2.03
  
• d2ckha1 appears in the current release, SCOPe 2.08