Lineage for d2ck3g1 (2ck3 G:1-270)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 834980Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 835096Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (1 family) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 835097Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 835098Protein ATP synthase (F1-ATPase), gamma subunit [52945] (3 species)
  7. 835099Species Cow (Bos taurus) [TaxId:9913] [52946] (14 PDB entries)
    Uniprot P05631
  8. 835101Domain d2ck3g1: 2ck3 G:1-270 [130562]
    Other proteins in same PDB: d2ck3a1, d2ck3a2, d2ck3a3, d2ck3b1, d2ck3b2, d2ck3b3, d2ck3c1, d2ck3c2, d2ck3c3, d2ck3d1, d2ck3d2, d2ck3d3, d2ck3e1, d2ck3e2, d2ck3e3, d2ck3f1, d2ck3f2, d2ck3f3, d2ck3h1, d2ck3h2
    automatically matched to d1bmfg_
    complexed with adp, anp, azi, mg, po4

Details for d2ck3g1

PDB Entry: 2ck3 (more details), 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase
PDB Compounds: (G:) ATP synthase gamma chain

SCOP Domain Sequences for d2ck3g1:

Sequence, based on SEQRES records: (download)

>d2ck3g1 c.49.2.1 (G:1-270) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaa

Sequence, based on observed residues (ATOM records): (download)

>d2ck3g1 c.49.2.1 (G:1-270) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgliigvssdrglcg
aihssvaiigvgdkirsiltfkevgrrpptfgdasvialelsiifnrfrsvisykteysl
aniiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisga
a

SCOP Domain Coordinates for d2ck3g1:

Click to download the PDB-style file with coordinates for d2ck3g1.
(The format of our PDB-style files is described here.)

Timeline for d2ck3g1: