Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries) Uniprot P00829 |
Domain d2ck3f3: 2ck3 F:82-357 [130561] Other proteins in same PDB: d2ck3a1, d2ck3a2, d2ck3a3, d2ck3b1, d2ck3b2, d2ck3b3, d2ck3c1, d2ck3c2, d2ck3c3, d2ck3d1, d2ck3d2, d2ck3e1, d2ck3e2, d2ck3f1, d2ck3f2, d2ck3g_, d2ck3h1, d2ck3h2, d2ck3i_ automated match to d1w0jd3 complexed with adp, anp, azi, mg, po4 |
PDB Entry: 2ck3 (more details), 1.9 Å
SCOPe Domain Sequences for d2ck3f3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ck3f3 c.37.1.11 (F:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d2ck3f3: