Lineage for d2ck3f3 (2ck3 F:82-357)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696819Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (16 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 696917Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)
  7. 696957Species Rat (Rattus norvegicus) [TaxId:10116] [88781] (4 PDB entries)
  8. 696963Domain d2ck3f3: 2ck3 F:82-357 [130561]
    Other proteins in same PDB: d2ck3d1, d2ck3d2, d2ck3e1, d2ck3e2, d2ck3f1, d2ck3f2, d2ck3g1, d2ck3h1, d2ck3h2
    automatically matched to d1mabb3
    complexed with adp, anp, azi, mg, po4

Details for d2ck3f3

PDB Entry: 2ck3 (more details), 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase
PDB Compounds: (F:) ATP synthase beta chain

SCOP Domain Sequences for d2ck3f3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ck3f3 c.37.1.11 (F:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOP Domain Coordinates for d2ck3f3:

Click to download the PDB-style file with coordinates for d2ck3f3.
(The format of our PDB-style files is described here.)

Timeline for d2ck3f3: