SCOPe 2.01: Domain d2ck3f1: 2ck3 F:358-474

Lineage for d2ck3f1 (2ck3 F:358-474)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88930] (4 PDB entries)

8. Domain d2ck3f1: 2ck3 F:358-474 [130559]
   Other proteins in same PDB: d2ck3a1, d2ck3a2, d2ck3a3, d2ck3b1, d2ck3b2, d2ck3b3, d2ck3c1, d2ck3c2, d2ck3c3, d2ck3d2, d2ck3d3, d2ck3e2, d2ck3e3, d2ck3f2, d2ck3f3, d2ck3g_, d2ck3h1, d2ck3h2, d2ck3i_
   automatically matched to d1mabb1
   complexed with adp, anp, azi, mg, po4

Details for d2ck3f1

PDB Entry: 2ck3, 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase

PDB Compounds: (F:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d2ck3f1:

Sequence; same for both SEQRES and ATOM records:

>d2ck3f1 a.69.1.1 (F:358-474) F1 ATP synthase beta subunit, domain 3 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

Timeline for d2ck3f1:

• d2ck3f1 first appeared in SCOP 1.73
  
• d2ck3f1 appears in SCOP 1.75
  
• d2ck3f1 appears in SCOPe 2.02
  
• d2ck3f1 appears in the current release, SCOPe 2.08