![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (3 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) ![]() |
![]() | Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
![]() | Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [88930] (4 PDB entries) |
![]() | Domain d2ck3f1: 2ck3 F:358-474 [130559] Other proteins in same PDB: d2ck3d2, d2ck3d3, d2ck3e2, d2ck3e3, d2ck3f2, d2ck3f3, d2ck3g1, d2ck3h1, d2ck3h2 automatically matched to d1mabb1 complexed with adp, anp, azi, mg, po4 |
PDB Entry: 2ck3 (more details), 1.9 Å
SCOP Domain Sequences for d2ck3f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ck3f1 a.69.1.1 (F:358-474) F1 ATP synthase beta subunit, domain 3 {Rat (Rattus norvegicus) [TaxId: 10116]} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla
Timeline for d2ck3f1: