Lineage for d2ck3f1 (2ck3 F:358-474)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643803Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 643804Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 643805Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 643851Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 643891Species Rat (Rattus norvegicus) [TaxId:10116] [88930] (4 PDB entries)
  8. 643897Domain d2ck3f1: 2ck3 F:358-474 [130559]
    Other proteins in same PDB: d2ck3d2, d2ck3d3, d2ck3e2, d2ck3e3, d2ck3f2, d2ck3f3, d2ck3g1, d2ck3h1, d2ck3h2
    automatically matched to d1mabb1
    complexed with adp, anp, azi, mg, po4

Details for d2ck3f1

PDB Entry: 2ck3 (more details), 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase
PDB Compounds: (F:) ATP synthase beta chain

SCOP Domain Sequences for d2ck3f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ck3f1 a.69.1.1 (F:358-474) F1 ATP synthase beta subunit, domain 3 {Rat (Rattus norvegicus) [TaxId: 10116]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d2ck3f1:

Click to download the PDB-style file with coordinates for d2ck3f1.
(The format of our PDB-style files is described here.)

Timeline for d2ck3f1: