Lineage for d2ck3e2 (2ck3 E:10-81)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671687Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 671688Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 671689Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 671735Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 671775Species Rat (Rattus norvegicus) [TaxId:10116] [88679] (4 PDB entries)
  8. 671780Domain d2ck3e2: 2ck3 E:10-81 [130557]
    Other proteins in same PDB: d2ck3d1, d2ck3d3, d2ck3e1, d2ck3e3, d2ck3f1, d2ck3f3, d2ck3g1, d2ck3h1, d2ck3h2
    automatically matched to d1mabb2
    complexed with adp, anp, azi, mg, po4

Details for d2ck3e2

PDB Entry: 2ck3 (more details), 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase
PDB Compounds: (E:) ATP synthase beta chain

SCOP Domain Sequences for d2ck3e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ck3e2 b.49.1.1 (E:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]}
tgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgtegl
vrgqkvldsgap

SCOP Domain Coordinates for d2ck3e2:

Click to download the PDB-style file with coordinates for d2ck3e2.
(The format of our PDB-style files is described here.)

Timeline for d2ck3e2: