![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() |
![]() | Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
![]() | Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [88679] (4 PDB entries) |
![]() | Domain d2ck3e2: 2ck3 E:10-81 [130557] Other proteins in same PDB: d2ck3d1, d2ck3d3, d2ck3e1, d2ck3e3, d2ck3f1, d2ck3f3, d2ck3g1, d2ck3h1, d2ck3h2 automatically matched to d1mabb2 complexed with adp, anp, azi, mg, po4 |
PDB Entry: 2ck3 (more details), 1.9 Å
SCOP Domain Sequences for d2ck3e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ck3e2 b.49.1.1 (E:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} tgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgtegl vrgqkvldsgap
Timeline for d2ck3e2: