Lineage for d2ck3d2 (2ck3 D:9-81)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1795771Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1795772Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1795773Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1795828Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 1795831Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries)
    Uniprot P00829
  8. 1795844Domain d2ck3d2: 2ck3 D:9-81 [130554]
    Other proteins in same PDB: d2ck3a1, d2ck3a2, d2ck3a3, d2ck3b1, d2ck3b2, d2ck3b3, d2ck3c1, d2ck3c2, d2ck3c3, d2ck3d1, d2ck3d3, d2ck3e1, d2ck3e3, d2ck3f1, d2ck3f3, d2ck3g_, d2ck3h1, d2ck3h2, d2ck3i_
    automated match to d1e79d2
    complexed with adp, anp, azi, mg, po4

Details for d2ck3d2

PDB Entry: 2ck3 (more details), 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase
PDB Compounds: (D:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d2ck3d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ck3d2 b.49.1.1 (D:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOPe Domain Coordinates for d2ck3d2:

Click to download the PDB-style file with coordinates for d2ck3d2.
(The format of our PDB-style files is described here.)

Timeline for d2ck3d2: