Lineage for d2cjtd_ (2cjt D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045102Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2045229Protein automated matches [190564] (2 species)
    not a true protein
  7. 2045244Species Norway rat (Rattus norvegicus) [TaxId:10116] [187552] (2 PDB entries)
  8. 2045247Domain d2cjtd_: 2cjt D: [130552]
    Other proteins in same PDB: d2cjta1
    automated match to d2cjta1
    complexed with edo, fmt

Details for d2cjtd_

PDB Entry: 2cjt (more details), 1.44 Å

PDB Description: structural basis for a munc13-1 homodimer - munc13-1 - rim heterodimer switch: c2-domains as versatile protein-protein interaction modules
PDB Compounds: (D:) unc-13 homolog a

SCOPe Domain Sequences for d2cjtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjtd_ b.7.1.1 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sllcvgvkkakfdgaqekfntyvtlkvqnvksttiavrgsqpsweqdfmfeinrldlglt
vevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimadseicgtkdptfhri
lldahfe

SCOPe Domain Coordinates for d2cjtd_:

Click to download the PDB-style file with coordinates for d2cjtd_.
(The format of our PDB-style files is described here.)

Timeline for d2cjtd_: