SCOPe 2.07: Domain d2cjtb_: 2cjt B:

Lineage for d2cjtb_ (2cjt B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)

6. Protein automated matches [190564] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187552] (2 PDB entries)

8. Domain d2cjtb_: 2cjt B: [130550]
   Other proteins in same PDB: d2cjta1
   automated match to d2cjta1
   complexed with edo, fmt

Details for d2cjtb_

PDB Entry: 2cjt, 1.44 Å

PDB Description: structural basis for a munc13-1 homodimer - munc13-1 - rim heterodimer switch: c2-domains as versatile protein-protein interaction modules

PDB Compounds: (B:) unc-13 homolog a

SCOPe Domain Sequences for d2cjtb_:

Sequence, based on SEQRES records:

>d2cjtb_ b.7.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ggvmsllcvgvkkakfdgaqekfntyvtlkvqnvksttiavrgsqpsweqdfmfeinrld
lgltvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimadseicgtkdpt
fhrilldahfe

Sequence, based on observed residues (ATOM records):

>d2cjtb_ b.7.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ggvmsllcvgvkkakfdgaqekfntyvtlkvqnvksttiavrgsqpsweqdfmfeinrld
lgltvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsgtkdptfhrilldahf
e

Timeline for d2cjtb_:

• d2cjtb_ first appeared in SCOP 1.73, called d2cjtb1
  
• d2cjtb_ appears in SCOPe 2.06
  
• d2cjtb_ appears in the current release, SCOPe 2.08