Lineage for d2cjsb2 (2cjs B:1-155)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382506Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2382507Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2382643Protein automated matches [190564] (3 species)
    not a true protein
  7. 2382662Species Norway rat (Rattus norvegicus) [TaxId:10116] [187552] (2 PDB entries)
  8. 2382666Domain d2cjsb2: 2cjs B:1-155 [130548]
    Other proteins in same PDB: d2cjsa1, d2cjsa2, d2cjsb3
    automated match to d2cjsa1
    complexed with edo, gol, zn

Details for d2cjsb2

PDB Entry: 2cjs (more details), 1.78 Å

PDB Description: structural basis for a munc13-1 homodimer - munc13-1 - rim heterodimer switch: c2-domains as versatile protein-protein interaction modules
PDB Compounds: (B:) unc-13 homolog a

SCOPe Domain Sequences for d2cjsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjsb2 b.7.1.1 (B:1-155) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsllcvgvkkakfdgaqekfntyvtlkvqnvesttiavrgsqpsweqdfmfeinrldlgl
tvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimadseicgtkdptfhr
illdahfelpldipeeearywakkleqlnaklnss

SCOPe Domain Coordinates for d2cjsb2:

Click to download the PDB-style file with coordinates for d2cjsb2.
(The format of our PDB-style files is described here.)

Timeline for d2cjsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cjsb3