![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
![]() | Protein automated matches [190564] (3 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [187552] (2 PDB entries) |
![]() | Domain d2cjsb2: 2cjs B:1-155 [130548] Other proteins in same PDB: d2cjsa1, d2cjsa2, d2cjsb3 automated match to d2cjsa1 complexed with edo, gol, zn |
PDB Entry: 2cjs (more details), 1.78 Å
SCOPe Domain Sequences for d2cjsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cjsb2 b.7.1.1 (B:1-155) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} lsllcvgvkkakfdgaqekfntyvtlkvqnvesttiavrgsqpsweqdfmfeinrldlgl tvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimadseicgtkdptfhr illdahfelpldipeeearywakkleqlnaklnss
Timeline for d2cjsb2: