SCOPe 2.08: Domain d2cjsb2: 2cjs B:1-155

Lineage for d2cjsb2 (2cjs B:1-155)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)

6. Protein automated matches [190564] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187552] (2 PDB entries)

8. Domain d2cjsb2: 2cjs B:1-155 [130548]
   Other proteins in same PDB: d2cjsa1, d2cjsa2, d2cjsb3
   automated match to d2cjsa1
   complexed with edo, gol, zn

Details for d2cjsb2

PDB Entry: 2cjs, 1.78 Å

PDB Description: structural basis for a munc13-1 homodimer - munc13-1 - rim heterodimer switch: c2-domains as versatile protein-protein interaction modules

PDB Compounds: (B:) unc-13 homolog a

SCOPe Domain Sequences for d2cjsb2:

Sequence; same for both SEQRES and ATOM records:

>d2cjsb2 b.7.1.1 (B:1-155) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsllcvgvkkakfdgaqekfntyvtlkvqnvesttiavrgsqpsweqdfmfeinrldlgl
tvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimadseicgtkdptfhr
illdahfelpldipeeearywakkleqlnaklnss

Timeline for d2cjsb2:

• d2cjsb2 first appeared in SCOP 1.73, called d2cjsb1
  
• d2cjsb2 appears in SCOPe 2.07