SCOP 1.75: Domain d2cjsa1: 2cjs A:2-150

Lineage for d2cjsa1 (2cjs A:2-150)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families)
   two constituent families are related by circular permutation

5. Family b.7.1.1: PLC-like (P variant) [49563] (11 proteins)

6. Protein Unc-13 homolog A [141105] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [141106] (2 PDB entries)
   Uniprot Q62768 1-128! Uniprot Q62768 2-150

8. Domain d2cjsa1: 2cjs A:2-150 [130547]
   complexed with edo, gol, zn; mutant

Details for d2cjsa1

PDB Entry: 2cjs, 1.78 Å

PDB Description: structural basis for a munc13-1 homodimer - munc13-1 - rim heterodimer switch: c2-domains as versatile protein-protein interaction modules

PDB Compounds: (A:) unc-13 homolog a

SCOP Domain Sequences for d2cjsa1:

Sequence; same for both SEQRES and ATOM records:

>d2cjsa1 b.7.1.1 (A:2-150) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]}
sllcvgvkkakfdgaqekfntyvtlkvqnvesttiavrgsqpsweqdfmfeinrldlglt
vevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimadseicgtkdptfhri
lldahfelpldipeeearywakkleqlna

Timeline for d2cjsa1:

• d2cjsa1 first appeared in SCOP 1.73
  
• d2cjsa1 appears in SCOPe 2.01
  
• d2cjsa1 appears in the current release, SCOPe 2.08