Lineage for d2cjmd1 (2cjm D:181-308)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644042Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 644043Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 644044Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 644055Protein Cyclin A [47956] (2 species)
  7. 644056Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries)
  8. 644085Domain d2cjmd1: 2cjm D:181-308 [130545]
    Other proteins in same PDB: d2cjma1, d2cjmc1
    automatically matched to d1vin_1
    complexed with atp, mg

Details for d2cjmd1

PDB Entry: 2cjm (more details), 2.3 Å

PDB Description: Mechanism of CDK inhibition by active site phosphorylation: CDK2 Y15p T160p in complex with cyclin A structure
PDB Compounds: (D:) cyclin a2

SCOP Domain Sequences for d2cjmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjmd1 a.74.1.1 (D:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

SCOP Domain Coordinates for d2cjmd1:

Click to download the PDB-style file with coordinates for d2cjmd1.
(The format of our PDB-style files is described here.)

Timeline for d2cjmd1: