Class a: All alpha proteins [46456] (286 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (75 PDB entries) Uniprot P20248 175-432 |
Domain d2cjmb1: 2cjm B:176-309 [130542] Other proteins in same PDB: d2cjma_, d2cjmc_ automated match to d1h1pb1 complexed with atp, mg |
PDB Entry: 2cjm (more details), 2.3 Å
SCOPe Domain Sequences for d2cjmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cjmb1 a.74.1.1 (B:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme hlvlkvltfdlaap
Timeline for d2cjmb1:
View in 3D Domains from other chains: (mouse over for more information) d2cjma_, d2cjmc_, d2cjmd1, d2cjmd2 |