SCOPe 2.05: Domain d2cjmb1: 2cjm B:176-309

Lineage for d2cjmb1 (2cjm B:176-309)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (75 PDB entries)
   Uniprot P20248 175-432

8. Domain d2cjmb1: 2cjm B:176-309 [130542]
   Other proteins in same PDB: d2cjma_, d2cjmc_
   automated match to d1h1pb1
   complexed with atp, mg

Details for d2cjmb1

PDB Entry: 2cjm, 2.3 Å

PDB Description: Mechanism of CDK inhibition by active site phosphorylation: CDK2 Y15p T160p in complex with cyclin A structure

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2cjmb1:

Sequence; same for both SEQRES and ATOM records:

>d2cjmb1 a.74.1.1 (B:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap

Timeline for d2cjmb1:

• d2cjmb1 first appeared in SCOP 1.73
  
• d2cjmb1 appears in SCOPe 2.04
  
• d2cjmb1 appears in SCOPe 2.06
  
• d2cjmb1 appears in the current release, SCOPe 2.08