Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) |
Protein automated matches [190071] (3 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [186791] (3 PDB entries) |
Domain d2cjfh_: 2cjf H: [130533] automated match to d1d0ia_ complexed with gol, po4, rp4, trs |
PDB Entry: 2cjf (more details), 1.95 Å
SCOPe Domain Sequences for d2cjfh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cjfh_ c.23.13.1 (H:) automated matches {Streptomyces coelicolor [TaxId: 1902]} rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy vsqradgvvagcgvqgyvfgveriaalag
Timeline for d2cjfh_: