Lineage for d2cjfh1 (2cjf H:1402-1550)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692549Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) (S)
  5. 692550Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)
  6. 692551Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)
  7. 692610Species Streptomyces coelicolor [TaxId:1902] [52308] (7 PDB entries)
  8. 692690Domain d2cjfh1: 2cjf H:1402-1550 [130533]
    automatically matched to d1d0ih_
    complexed with gol, po4, rp4, trs

Details for d2cjfh1

PDB Entry: 2cjf (more details), 1.95 Å

PDB Description: type ii dehydroquinase inhibitor complex
PDB Compounds: (H:) 3-dehydroquinate dehydratase

SCOP Domain Sequences for d2cjfh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjfh1 c.23.13.1 (H:1402-1550) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]}
rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag

SCOP Domain Coordinates for d2cjfh1:

Click to download the PDB-style file with coordinates for d2cjfh1.
(The format of our PDB-style files is described here.)

Timeline for d2cjfh1: