| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) ![]() |
| Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein) |
| Protein Type II 3-dehydroquinate dehydratase [52306] (5 species) |
| Species Streptomyces coelicolor [TaxId:1902] [52308] (7 PDB entries) |
| Domain d2cjfb1: 2cjf B:202-350 [130527] automatically matched to d1d0ih_ complexed with gol, po4, rp4, trs |
PDB Entry: 2cjf (more details), 1.95 Å
SCOP Domain Sequences for d2cjfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cjfb1 c.23.13.1 (B:202-350) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]}
rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag
Timeline for d2cjfb1: