Lineage for d2cjfa_ (2cjf A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466085Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2466086Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2466200Protein automated matches [190071] (5 species)
    not a true protein
  7. 2466498Species Streptomyces coelicolor [TaxId:1902] [186791] (3 PDB entries)
  8. 2466511Domain d2cjfa_: 2cjf A: [130526]
    automated match to d1d0ia_
    complexed with gol, po4, rp4, trs

Details for d2cjfa_

PDB Entry: 2cjf (more details), 1.95 Å

PDB Description: type ii dehydroquinase inhibitor complex
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2cjfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjfa_ c.23.13.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
vsqradgvvagcgvqgyvfgveriaalag

SCOPe Domain Coordinates for d2cjfa_:

Click to download the PDB-style file with coordinates for d2cjfa_.
(The format of our PDB-style files is described here.)

Timeline for d2cjfa_: