Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.2: Dodecin-like [89807] (2 families) |
Family d.230.2.1: Dodecin-like [89808] (3 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name automatically mapped to Pfam PF07311 |
Protein automated matches [190247] (4 species) not a true protein |
Species Halobacterium salinarium [TaxId:2242] [187030] (3 PDB entries) |
Domain d2cjca_: 2cjc A: [130525] automated match to d1moga_ complexed with cl, fad, mg, na, so4 |
PDB Entry: 2cjc (more details), 1.85 Å
SCOPe Domain Sequences for d2cjca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cjca_ d.230.2.1 (A:) automated matches {Halobacterium salinarium [TaxId: 2242]} vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqva feld
Timeline for d2cjca_: