SCOP 1.73: Domain d2cjca1: 2cjc A:2-65

Lineage for d2cjca1 (2cjc A:2-65)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.230: Dodecin subunit-like [88797] (5 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.2: Flavin-binding protein dodecin [89807] (1 family)

5. Family d.230.2.1: Flavin-binding protein dodecin [89808] (1 protein)
   Subunit assembly and a probable biological unit is a dodecamer, hence the name

6. Protein Flavin-binding protein dodecin [89809] (1 species)

7. Species Archaeon Halobacterium salinarum [TaxId:2242] [89810] (10 PDB entries)

8. Domain d2cjca1: 2cjc A:2-65 [130525]
   automatically matched to d1moga_
   complexed with cl, fad, mg, na, so4

Details for d2cjca1

PDB Entry: 2cjc, 1.85 Å

PDB Description: complexes of dodecin with flavin and flavin-like ligands

PDB Compounds: (A:) vng1446h

SCOP Domain Sequences for d2cjca1:

Sequence; same for both SEQRES and ATOM records:

>d2cjca1 d.230.2.1 (A:2-65) Flavin-binding protein dodecin {Archaeon Halobacterium salinarum [TaxId: 2242]}
vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqva
feld

Timeline for d2cjca1:

• d2cjca1 is new in SCOP 1.73
  
• d2cjca1 appears in SCOP 1.75
  
• d2cjca1 appears in the current release, SCOPe 2.08, called d2cjca_