SCOP 1.73: Domain d2cj8b1: 2cj8 B:5-149

Lineage for d2cj8b1 (2cj8 B:5-149)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.29: Bromodomain-like [47363] (10 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (1 family)
   contains a short alpha-hairpin at the N-terminal extension

5. Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (2 proteins)
   Pfam PF04043

6. Protein Invertase inhibitor [101150] (1 species)

7. Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [101151] (7 PDB entries)

8. Domain d2cj8b1: 2cj8 B:5-149 [130524]
   automatically matched to d1rj1a_
   complexed with iod

Details for d2cj8b1

PDB Entry: 2cj8, 2.38 Å

PDB Description: crystal structure of a cell wall invertase inhibitor from tobacco (ph 9.5)

PDB Compounds: (B:) invertase inhibitor

SCOP Domain Sequences for d2cj8b1:

Sequence; same for both SEQRES and ATOM records:

>d2cj8b1 a.29.6.1 (B:5-149) Invertase inhibitor {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}
nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
kspfsalniavhelsdvgraivrnl

Timeline for d2cj8b1:

• d2cj8b1 is new in SCOP 1.73
  
• d2cj8b1 appears in SCOP 1.75
  
• d2cj8b1 appears in the current release, SCOPe 2.08, called d2cj8b_