Lineage for d2cj8a_ (2cj8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708802Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 2708803Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins)
    Pfam PF04043
  6. 2708819Protein automated matches [190250] (1 species)
    not a true protein
  7. 2708820Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187032] (6 PDB entries)
  8. 2708832Domain d2cj8a_: 2cj8 A: [130523]
    automated match to d1rj1a_
    complexed with iod

Details for d2cj8a_

PDB Entry: 2cj8 (more details), 2.38 Å

PDB Description: crystal structure of a cell wall invertase inhibitor from tobacco (ph 9.5)
PDB Compounds: (A:) invertase inhibitor

SCOPe Domain Sequences for d2cj8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cj8a_ a.29.6.1 (A:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkg
skspfsalniavhelsdvgraivrnll

SCOPe Domain Coordinates for d2cj8a_:

Click to download the PDB-style file with coordinates for d2cj8a_.
(The format of our PDB-style files is described here.)

Timeline for d2cj8a_: