![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families) ![]() contains a short alpha-hairpin at the N-terminal extension |
![]() | Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins) Pfam PF04043 |
![]() | Protein automated matches [190250] (1 species) not a true protein |
![]() | Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187032] (6 PDB entries) |
![]() | Domain d2cj6a_: 2cj6 A: [130521] automated match to d1rj1a_ complexed with iod |
PDB Entry: 2cj6 (more details), 2 Å
SCOPe Domain Sequences for d2cj6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cj6a_ a.29.6.1 (A:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]} nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs kspfsalniavhelsdvgraivrnll
Timeline for d2cj6a_: