SCOPe 2.06: Domain d2cj5a_: 2cj5 A:

Lineage for d2cj5a_ (2cj5 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families)
   contains a short alpha-hairpin at the N-terminal extension

5. Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins)
   Pfam PF04043

6. Protein automated matches [190250] (1 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187032] (6 PDB entries)

8. Domain d2cj5a_: 2cj5 A: [130520]
   automated match to d1rj1a_
   complexed with act, so4

Details for d2cj5a_

PDB Entry: 2cj5, 1.84 Å

PDB Description: crystal structure of a cell wall invertase inhibitor from tobacco (ph 5.0)

PDB Compounds: (A:) invertase inhibitor

SCOPe Domain Sequences for d2cj5a_:

Sequence; same for both SEQRES and ATOM records:

>d2cj5a_ a.29.6.1 (A:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkg
skspfsalniavhelsdvgraivrnll

Timeline for d2cj5a_:

• d2cj5a_ first appeared in SCOP 1.73, called d2cj5a1
  
• d2cj5a_ appears in SCOPe 2.05
  
• d2cj5a_ appears in SCOPe 2.07
  
• d2cj5a_ appears in the current release, SCOPe 2.08