SCOPe 2.07: Domain d2cj4b_: 2cj4 B:

Lineage for d2cj4b_ (2cj4 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families)
   contains a short alpha-hairpin at the N-terminal extension

5. Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins)
   Pfam PF04043

6. Protein automated matches [190250] (1 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187032] (6 PDB entries)

8. Domain d2cj4b_: 2cj4 B: [130519]
   automated match to d1rj1a_
   complexed with act, so4

Details for d2cj4b_

PDB Entry: 2cj4, 1.63 Å

PDB Description: crystal structure of a cell wall invertase inhibitor from tobacco at ph 4.6

PDB Compounds: (B:) invertase inhibitor

SCOPe Domain Sequences for d2cj4b_:

Sequence; same for both SEQRES and ATOM records:

>d2cj4b_ a.29.6.1 (B:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
kspfsalniavhelsdvgraivrnll

Timeline for d2cj4b_:

• d2cj4b_ first appeared in SCOP 1.73, called d2cj4b1
  
• d2cj4b_ appears in SCOPe 2.06
  
• d2cj4b_ appears in the current release, SCOPe 2.08