SCOP 1.75: Domain d2cj4a1: 2cj4 A:4-150

Lineage for d2cj4a1 (2cj4 A:4-150)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (1 family)
   contains a short alpha-hairpin at the N-terminal extension

5. Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (2 proteins)
   Pfam PF04043

6. Protein Invertase inhibitor [101150] (1 species)

7. Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [101151] (7 PDB entries)

8. Domain d2cj4a1: 2cj4 A:4-150 [130518]
   automatically matched to d1rj1a_
   complexed with act, so4

Details for d2cj4a1

PDB Entry: 2cj4, 1.63 Å

PDB Description: crystal structure of a cell wall invertase inhibitor from tobacco at ph 4.6

PDB Compounds: (A:) invertase inhibitor

SCOP Domain Sequences for d2cj4a1:

Sequence; same for both SEQRES and ATOM records:

>d2cj4a1 a.29.6.1 (A:4-150) Invertase inhibitor {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}
nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkg
skspfsalniavhelsdvgraivrnll

Timeline for d2cj4a1:

• d2cj4a1 first appeared in SCOP 1.73
  
• d2cj4a1 is called d2cj4a_ in SCOPe 2.01
  
• d2cj4a1 appears in the current release, SCOPe 2.08, called d2cj4a_