Lineage for d2cj3b_ (2cj3 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940172Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 940491Protein Plastocyanin [49507] (16 species)
  7. 940510Species Nostoc sp. PCC 7120 [TaxId:103690] [187031] (1 PDB entry)
  8. 940512Domain d2cj3b_: 2cj3 B: [130517]
    automated match to d1fa4a_
    complexed with cu

Details for d2cj3b_

PDB Entry: 2cj3 (more details), 1.7 Å

PDB Description: crystal structure of plastocyanin from a cyanobacterium, anabaena variabilis
PDB Compounds: (B:) plastocyanin

SCOPe Domain Sequences for d2cj3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cj3b_ b.6.1.1 (B:) Plastocyanin {Nostoc sp. PCC 7120 [TaxId: 103690]}
etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls
hkqllmspgqststtfpadapageytfycephrgagmvgkitvag

SCOPe Domain Coordinates for d2cj3b_:

Click to download the PDB-style file with coordinates for d2cj3b_.
(The format of our PDB-style files is described here.)

Timeline for d2cj3b_: