SCOP 1.75: Domain d2cj3b1: 2cj3 B:1-105

Lineage for d2cj3b1 (2cj3 B:1-105)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (14 species)

7. Species Anabaena variabilis [TaxId:1172] [49517] (5 PDB entries)

8. Domain d2cj3b1: 2cj3 B:1-105 [130517]
   automatically matched to d1fa4a_
   complexed with cu

Details for d2cj3b1

PDB Entry: 2cj3, 1.7 Å

PDB Description: crystal structure of plastocyanin from a cyanobacterium, anabaena variabilis

PDB Compounds: (B:) plastocyanin

SCOP Domain Sequences for d2cj3b1:

Sequence; same for both SEQRES and ATOM records:

>d2cj3b1 b.6.1.1 (B:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]}
etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls
hkqllmspgqststtfpadapageytfycephrgagmvgkitvag

Timeline for d2cj3b1:

• d2cj3b1 first appeared in SCOP 1.73
  
• d2cj3b1 is called d2cj3b_ in SCOPe 2.01
  
• d2cj3b1 appears in the current release, SCOPe 2.08, called d2cj3b_