Lineage for d2cj3b1 (2cj3 B:1-105)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660500Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 660737Protein Plastocyanin [49507] (14 species)
  7. 660738Species Anabaena variabilis [TaxId:1172] [49517] (5 PDB entries)
  8. 660740Domain d2cj3b1: 2cj3 B:1-105 [130517]
    automatically matched to d1fa4a_
    complexed with cu

Details for d2cj3b1

PDB Entry: 2cj3 (more details), 1.7 Å

PDB Description: crystal structure of plastocyanin from a cyanobacterium, anabaena variabilis
PDB Compounds: (B:) plastocyanin

SCOP Domain Sequences for d2cj3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cj3b1 b.6.1.1 (B:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]}
etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls
hkqllmspgqststtfpadapageytfycephrgagmvgkitvag

SCOP Domain Coordinates for d2cj3b1:

Click to download the PDB-style file with coordinates for d2cj3b1.
(The format of our PDB-style files is described here.)

Timeline for d2cj3b1: