SCOPe 2.08: Domain d2cj3b_: 2cj3 B:

Lineage for d2cj3b_ (2cj3 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (17 species)

7. Species Nostoc sp. PCC 7120 [TaxId:103690] [187031] (1 PDB entry)

8. Domain d2cj3b_: 2cj3 B: [130517]
   automated match to d1fa4a_
   complexed with cu

Details for d2cj3b_

PDB Entry: 2cj3, 1.7 Å

PDB Description: crystal structure of plastocyanin from a cyanobacterium, anabaena variabilis

PDB Compounds: (B:) plastocyanin

SCOPe Domain Sequences for d2cj3b_:

Sequence; same for both SEQRES and ATOM records:

>d2cj3b_ b.6.1.1 (B:) Plastocyanin {Nostoc sp. PCC 7120 [TaxId: 103690]}
etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls
hkqllmspgqststtfpadapageytfycephrgagmvgkitvag

Timeline for d2cj3b_:

• d2cj3b_ first appeared in SCOP 1.73, called d2cj3b1
  
• d2cj3b_ appears in SCOPe 2.07