Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Plastocyanin [49507] (17 species) |
Species Nostoc sp. PCC 7120 [TaxId:103690] [187031] (1 PDB entry) |
Domain d2cj3a_: 2cj3 A: [130516] automated match to d1fa4a_ complexed with cu |
PDB Entry: 2cj3 (more details), 1.7 Å
SCOPe Domain Sequences for d2cj3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cj3a_ b.6.1.1 (A:) Plastocyanin {Nostoc sp. PCC 7120 [TaxId: 103690]} etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls hkqllmspgqststtfpadapageytfycephrgagmvgkitvag
Timeline for d2cj3a_: