| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.3: Cloroperoxidase [47571] (1 family) ![]() duplication: consists of 2 similar domains composed of 2 EF hand-like motifs each |
| Family a.39.3.1: Cloroperoxidase [47572] (1 protein) |
| Protein Cloroperoxidase [47573] (1 species) |
| Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (13 PDB entries) |
| Domain d2cj0a2: 2cj0 A:120-298 [130511] automated match to d1cpoa2 complexed with edo, hem, man, mn, nag, no3 |
PDB Entry: 2cj0 (more details), 1.75 Å
SCOPe Domain Sequences for d2cj0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cj0a2 a.39.3.1 (A:120-298) Cloroperoxidase {Fungus (Caldariomyces fumago) [TaxId: 5474]}
nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd
Timeline for d2cj0a2: