SCOPe 2.08: Domain d2cj0a2: 2cj0 A:120-298

Lineage for d2cj0a2 (2cj0 A:120-298)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.3: Cloroperoxidase [47571] (1 family)
   duplication: consists of 2 similar domains composed of 2 EF hand-like motifs each

5. Family a.39.3.1: Cloroperoxidase [47572] (1 protein)

6. Protein Cloroperoxidase [47573] (1 species)

7. Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (13 PDB entries)

8. Domain d2cj0a2: 2cj0 A:120-298 [130511]
   automated match to d1cpoa2
   complexed with edo, hem, man, mn, nag, no3

Details for d2cj0a2

PDB Entry: 2cj0, 1.75 Å

PDB Description: chloroperoxidase complexed with nitrate

PDB Compounds: (A:) chloroperoxidase

SCOPe Domain Sequences for d2cj0a2:

Sequence; same for both SEQRES and ATOM records:

>d2cj0a2 a.39.3.1 (A:120-298) Cloroperoxidase {Fungus (Caldariomyces fumago) [TaxId: 5474]}
nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd

Timeline for d2cj0a2:

• d2cj0a2 first appeared in SCOP 1.73
  
• d2cj0a2 appears in SCOPe 2.07