SCOP 1.73: Domain d2ciwa2: 2ciw A:120-298

Lineage for d2ciwa2 (2ciw A:120-298)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.3: Cloroperoxidase [47571] (1 family)
   duplication: consists of 2 similar domains composed of 2 EF hand-like motifs each

5. Family a.39.3.1: Cloroperoxidase [47572] (1 protein)

6. Protein Cloroperoxidase [47573] (1 species)

7. Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (13 PDB entries)

8. Domain d2ciwa2: 2ciw A:120-298 [130503]
   automatically matched to d1cpo_2
   complexed with bma, hem, iod, man, mn, nag

Details for d2ciwa2

PDB Entry: 2ciw, 1.15 Å

PDB Description: chloroperoxidase iodide complex

PDB Compounds: (A:) chloroperoxidase

SCOP Domain Sequences for d2ciwa2:

Sequence; same for both SEQRES and ATOM records:

>d2ciwa2 a.39.3.1 (A:120-298) Cloroperoxidase {Fungus (Caldariomyces fumago) [TaxId: 5474]}
nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd

Timeline for d2ciwa2:

• d2ciwa2 is new in SCOP 1.73
  
• d2ciwa2 appears in SCOP 1.75
  
• d2ciwa2 appears in the current release, SCOPe 2.08