Lineage for d2ciwa1 (2ciw A:0-119)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 769348Superfamily a.39.3: Cloroperoxidase [47571] (1 family) (S)
    duplication: consists of 2 similar domains composed of 2 EF hand-like motifs each
  5. 769349Family a.39.3.1: Cloroperoxidase [47572] (1 protein)
  6. 769350Protein Cloroperoxidase [47573] (1 species)
  7. 769351Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (13 PDB entries)
  8. 769352Domain d2ciwa1: 2ciw A:0-119 [130502]
    automatically matched to d1cpo_1
    complexed with bma, hem, iod, man, mn, nag

Details for d2ciwa1

PDB Entry: 2ciw (more details), 1.15 Å

PDB Description: chloroperoxidase iodide complex
PDB Compounds: (A:) chloroperoxidase

SCOP Domain Sequences for d2ciwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ciwa1 a.39.3.1 (A:0-119) Cloroperoxidase {Fungus (Caldariomyces fumago) [TaxId: 5474]}
eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva

SCOP Domain Coordinates for d2ciwa1:

Click to download the PDB-style file with coordinates for d2ciwa1.
(The format of our PDB-style files is described here.)

Timeline for d2ciwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ciwa2