![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.3: Cloroperoxidase [47571] (1 family) ![]() duplication: consists of 2 similar domains composed of 2 EF hand-like motifs each |
![]() | Family a.39.3.1: Cloroperoxidase [47572] (1 protein) |
![]() | Protein Cloroperoxidase [47573] (1 species) |
![]() | Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (13 PDB entries) |
![]() | Domain d2ciwa1: 2ciw A:0-119 [130502] automated match to d1cpoa1 complexed with hem, iod, man, mn, nag |
PDB Entry: 2ciw (more details), 1.15 Å
SCOPe Domain Sequences for d2ciwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ciwa1 a.39.3.1 (A:0-119) Cloroperoxidase {Fungus (Caldariomyces fumago) [TaxId: 5474]} eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva
Timeline for d2ciwa1: