![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Endoglucanase H N-terminal domain [141783] (1 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [141784] (2 PDB entries) Uniprot P16218 29-304! Uniprot P16218 31-304 |
![]() | Domain d2cita1: 2cit A:9-282 [130499] |
PDB Entry: 2cit (more details), 1.4 Å
SCOPe Domain Sequences for d2cita1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cita1 c.1.8.3 (A:9-282) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} lkigawvgtqpsesaiksfqelqgrkldivhqfinwstdfswvrpyadavynngsilmit wepweyntvdikngkadayitrmaqdmkaygkeiwlrplhaangdwypwaigyssrvntn etyiaafrhivdifrangatnvkwvfnvncdnvgngtsylghypgdnyvdytsidgynwg ttqswgsqwqsfdqvfsrayqalasinkpiiiaefasaeiggnkarwiteaynsirtsyn kviaavwfhenketdwrinsspealaayreaiga
Timeline for d2cita1: